GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0 items
New Products
Product Details
Winter Leaves Seasons Greetings Cards
Winter Leaves Seasons Greetings Cards
Winter Leaves Seasons Greetings Cards
Winter Leaves Seasons Greetings Cards
Winter Leaves Seasons Greetings Cards
Winter Leaves Seasons Greetings Cards
Product Code:MRFGC-Leaves-#-L/S
Product Condition:New
£0.00 inc. tax
Add to Cart
Description
Molly Rose Foundation 'Winter Leaves' Season's Greetings card packs including self seal envelopes.

Card size Small  100mm x 100mm - 4"x 4"
Card size Large  148mm x 148mm - 6"x 6"

The card is blank inside for your own greeting

Upon check-out a delivery charge will be added to your order which reflects the actual cost to the Molly Rose Foundation of postage and packaging.
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i